PDB entry 1jrm

View 1jrm on RCSB PDB site
Description: nmr structure of mth0637. ontario centre for structural proteomics target mth0637_1_104; northeast structural genomics target tt135
Deposited on 2001-08-14, released 2002-02-27
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1jrma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jrmA (A:)
  vitmdclrevgddllvnievspasgkfgipsynewrkrievkihsppqkgkanreiikef
  setfgrdveivsgqksrqktiriqgmgrdlflklvsekfgleip