PDB entry 1jrl

View 1jrl on RCSB PDB site
Description: Crystal structure of E. coli Lysophospholiase L1/Acyl-CoA Thioesterase I/Protease I L109P mutant
Class: hydrolase
Keywords: Hydrolase, Protease
Deposited on 2001-08-14, released 2003-07-08
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-06, with a file datestamp of 2008-05-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.195
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA Thioesterase I
    Species: ESCHERICHIA COLI
    Gene: tesA, apeA, pldC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29679 (0-End)
      • engineered (108)
    Domains in SCOP 1.75: d1jrla_
  • Heterogens: SO4, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jrlA (A:)
    adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh
    dslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrlA (A:)
    adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
    qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrryneaf
    saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn