PDB entry 1jrk

View 1jrk on RCSB PDB site
Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets
Deposited on 2001-08-13, released 2002-04-03
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jrka_
  • Chain 'B':
    Domains in SCOP 1.61: d1jrkb_
  • Chain 'C':
    Domains in SCOP 1.61: d1jrkc_
  • Chain 'D':
    Domains in SCOP 1.61: d1jrkd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrkA (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrkB (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrkC (C:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrkD (D:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaale