PDB entry 1jrk

View 1jrk on RCSB PDB site
Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets
Class: structural genomics, unknown function
Keywords: Nudix/mutT-like fold, mixed alpha/beta, tetramerization due to Hix6x tag, putative Nudix hydrolase, structural genomics, UNKNOWN FUNCTION
Deposited on 2001-08-13, released 2002-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jrka1, d1jrka2
  • Chain 'B':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jrkb1, d1jrkb2
  • Chain 'C':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jrkc1, d1jrkc2
  • Chain 'D':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jrkd1, d1jrkd2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jrkA (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrkA (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jrkB (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrkB (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jrkC (C:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrkC (C:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jrkD (D:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrkD (D:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaale