PDB entry 1jrj

View 1jrj on RCSB PDB site
Description: Solution structure of exendin-4 in 30-vol% trifluoroethanol
Class: hormone/growth factor
Keywords: Trp-cage, GLP-1, poly-proII, hydrophobic cluster, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-08-13, released 2001-11-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exendin-4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1jrja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrjA (A:)
    hgegtftsdlskqmeeeavrlfiewlknggpssgappps