PDB entry 1jrg

View 1jrg on RCSB PDB site
Description: Crystal Structure of the R3 form of Pectate Lyase A, Erwinia chrysanthemi
Class: lyase
Keywords: parallel beta helix beta elimination
Deposited on 2001-08-13, released 2002-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: Erwinia chrysanthemi
    Gene: PELA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jrga_
  • Chain 'B':
    Compound: pectate lyase
    Species: Erwinia chrysanthemi
    Gene: PELA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jrgb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jrgA (A:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighndtnsaqdkgklhvtlfnnvfnrvte
    raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
    vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrgA (A:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighdkgklhvtlfnnvfnrvteraprvry
    gsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackvvkkfngs
    ifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jrgB (B:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmlighndtnsaqdkgklhvtlfnnvfnrvte
    raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
    vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrgB (B:)
    aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
    gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
    vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
    vqhdgaldikrgsdyvtisnslidqhdktmligklhvtlfnnvfnrvteraprvrygsih
    sfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackvvkkfngsifsd
    ngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgkl