PDB entry 1jrf

View 1jrf on RCSB PDB site
Description: NMR Solution Structure of the Viral Receptor Domain of Tva
Class: signaling protein, membrane protein
Keywords: disulfide bond, alpha helix, calcium cage, signaling protein, membrane protein
Deposited on 2001-08-13, released 2002-03-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: subgroup a rous sarcoma virus receptors pg800 and pg950
  Species: Coturnix japonica [TaxId:93934]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98162 (0-46)
    • cloning artifact (0-1)
  Domains in SCOPe 2.01: d1jrfa_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jrfA (A:)
  gssrcppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcgts