PDB entry 1jrf

View 1jrf on RCSB PDB site
Description: NMR Solution Structure of the Viral Receptor Domain of Tva
Class: signaling protein, membrane protein
Keywords: disulfide bond, alpha helix, calcium cage
Deposited on 2001-08-13, released 2002-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subgroup a rous sarcoma virus receptors pg800 and pg950
    Species: Coturnix coturnix japonica
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98162 (0-46)
      • cloning artifact (0-1)
    Domains in SCOP 1.75: d1jrfa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrfA (A:)
    gssrcppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcgts