PDB entry 1jre

View 1jre on RCSB PDB site
Description: dna protection and binding by e. coli dps protein
Deposited on 2001-08-13, released 2003-06-17
The last revision prior to the SCOP 1.69 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jrea_
  • Chain 'B':
    Domains in SCOP 1.69: d1jreb_
  • Chain 'C':
    Domains in SCOP 1.69: d1jrec_
  • Chain 'D':
    Domains in SCOP 1.69: d1jred_
  • Chain 'E':
    Domains in SCOP 1.69: d1jree_
  • Chain 'F':
    Domains in SCOP 1.69: d1jref_
  • Chain 'G':
    Domains in SCOP 1.69: d1jreg_
  • Chain 'H':
    Domains in SCOP 1.69: d1jreh_
  • Chain 'I':
    Domains in SCOP 1.69: d1jrei_
  • Chain 'J':
    Domains in SCOP 1.69: d1jrej_
  • Chain 'K':
    Domains in SCOP 1.69: d1jrek_
  • Chain 'L':
    Domains in SCOP 1.69: d1jrel_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jreA (A:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreA (A:)
    atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
    talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
    dvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jreB (B:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreB (B:)
    atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
    talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
    dvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jreC (C:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreC (C:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jreD (D:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreD (D:)
    atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
    talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
    dvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jreE (E:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreE (E:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jreF (F:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreF (F:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jreG (G:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreG (G:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jreH (H:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreH (H:)
    atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
    talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
    dvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1jreI (I:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreI (I:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1jreJ (J:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreJ (J:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1jreK (K:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreK (K:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jreL (L:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jreL (L:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie