PDB entry 1jr9

View 1jr9 on RCSB PDB site
Description: Crystal Structure of manganese superoxide dismutases from Bacillus halodenitrificans
Deposited on 2001-08-13, released 2002-08-13
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-13, with a file datestamp of 2002-08-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jr9A (A:)
    kfelpelpyaydaleptidketmnihhtkhhntyvtklngaleghedlknkslndlisnl
    davpenirtavrnnggghanhslfwklmspngggkptgevadkindkygsfekfqeefaa
    aaagrfgsgwawlvvnngeieimstpiqdnplmegkkpilgldvwehayylkyqnkrpdy
    isafwnvvnwdevaaqysqaa