PDB entry 1jr8

View 1jr8 on RCSB PDB site
Description: Crystal Structure of Erv2p
Deposited on 2001-08-13, released 2001-12-28
The last revision prior to the SCOP 1.63 freeze date was dated 2001-12-28, with a file datestamp of 2001-12-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.208
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jr8a_
  • Chain 'B':
    Domains in SCOP 1.63: d1jr8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jr8A (A:)
    ddkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvklie
    kypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jr8B (B:)
    dkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvkliek
    ypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgcs