PDB entry 1jr7

View 1jr7 on RCSB PDB site
Description: crystal structure of gab reveals oxidoreductase fold
Class: oxidoreductase, lyase
Keywords: GAMMA AMINO-BUTYRIC ACID METABOLISM, GABA, FERROUS OXYGENASE, 2-OXOGLUTARATE, OXIDOREDUCTASE, ANTIBIOTICS BIOSYNTHESIS, OXYGENASE, B-LACTAM, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LYASE
Deposited on 2001-08-12, released 2001-08-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 37.4 kda protein in iley-gabd intergenic region
    Species: Escherichia coli [TaxId:562]
    Gene: GAB; YGAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jr7a_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jr7A (A:)
    gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl
    canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy
    yarfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhld
    dwehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfe
    egvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyf
    ayasnhyqthq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr7A (A:)
    gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl
    canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy
    yarfvvknvylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehl
    dnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwl
    selsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasn
    hyqthq