PDB entry 1jr5

View 1jr5 on RCSB PDB site
Description: Solution Structure of the Anti-Sigma Factor AsiA Homodimer
Class: transcription
Keywords: All-alpha, Helix-Turn-Helix, Coiled-Coil, TRANSCRIPTION
Deposited on 2001-08-10, released 2002-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10 KDA Anti-Sigma Factor
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: asiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jr5a_
  • Chain 'B':
    Compound: 10 KDA Anti-Sigma Factor
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: asiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jr5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jr5A (A:)
    mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
    ltqedkktlidefnegfegvyrylemytnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jr5B (B:)
    mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
    ltqedkktlidefnegfegvyrylemytnk