PDB entry 1jr3

View 1jr3 on RCSB PDB site
Description:
Deposited on 2001-08-10, released 2001-09-26
The last revision prior to the SCOP 1.67 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.268
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jr3a1, d1jr3a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jr3b1, d1jr3b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jr3c1, d1jr3c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jr3d1, d1jr3d2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jr3e1, d1jr3e2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jr3A (A:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr3A (A:)
    yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
    ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
    ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
    irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
    tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
    gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
    mplpep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jr3B (B:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr3B (B:)
    qvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgln
    cetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvy
    lidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqi
    rhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    ldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalg
    ndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprm
    plpep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jr3C (C:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr3C (C:)
    yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
    ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
    ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
    irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
    tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
    gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
    mplpep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jr3D (D:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr3D (D:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkplad
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jr3E (E:)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqailgdvchireql
    msvtginrellitdlllriehylqpgvvlpvphl