PDB entry 1jr1

View 1jr1 on RCSB PDB site
Description: Crystal structure of Inosine Monophosphate Dehydrogenase in complex with Mycophenolic Acid
Class: oxidoreductase
Keywords: dehydrogenase, impd, impdh, guanine nucleotide synthesis, mycophenolic acid, mpa, oxidoreductase
Deposited on 2001-08-09, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-5'-monophosphate dehydrogenase 2
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jr1a1, d1jr1a4
  • Chain 'B':
    Compound: Inosine-5'-monophosphate dehydrogenase 2
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jr1b1
  • Heterogens: K, IMP, MOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jr1A (A:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdrfleeimt
    kredlvvapagitlkeaneilqrskkgklpivnendelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr1A (A:)
    gltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspmdtvtea
    gmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvvdrvrfeakmgsrlvim
    tkredlvvapagitlkeaneilqrsklpivnendelvaiiartdlkknrdyplaskdakk
    qllcgaaigtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqvigg
    nvvtaaqaknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpvi
    adggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamik
    vaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaq
    veggvhslhsyekrlf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jr1B (B:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdrfleeimt
    kredlvvapagitlkeaneilqrskkgklpivnendelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr1B (B:)
    syvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspm
    dtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqyplaskdakkqllcgaai
    gtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqviggnvvtaaqa
    knlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpviadggiqnv
    ghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamikvaqgvsga
    vqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaqveggvhsl
    hsyekrlf