PDB entry 1jr1

View 1jr1 on RCSB PDB site
Description: crystal structure of inosine monophosphate dehydrogenase in complex with mycophenolic acid
Deposited on 2001-08-09, released 2001-09-05
The last revision prior to the SCOP 1.67 freeze date was dated 2001-09-05, with a file datestamp of 2001-09-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jr1A (A:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdrfleeimt
    kredlvvapagitlkeaneilqrskkgklpivnendelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr1A (A:)
    gltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspmdtvtea
    gmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvvdrvrfeakmgsrlvim
    tkredlvvapagitlkeaneilqrsklpivnendelvaiiartdlkknrdyplaskdakk
    qllcgaaigtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqvigg
    nvvtaaqaknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpvi
    adggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamik
    vaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaq
    veggvhslhsyekrlf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jr1B (B:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdrfleeimt
    kredlvvapagitlkeaneilqrskkgklpivnendelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr1B (B:)
    syvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspm
    dtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqyplaskdakkqllcgaai
    gtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqviggnvvtaaqa
    knlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpviadggiqnv
    ghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamikvaqgvsga
    vqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaqveggvhsl
    hsyekrlf