PDB entry 1jr0

View 1jr0 on RCSB PDB site
Description: cholera toxin b-pentamer with ligand bmsc-0011
Class: toxin
Keywords: enterotoxin, receptor, b-pentamer, toxin
Deposited on 2001-08-09, released 2002-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.131
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.06: d1jr0d_
• Chain 'E':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.06: d1jr0e_
• Chain 'F':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.06: d1jr0f_
• Chain 'G':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.06: d1jr0g_
• Chain 'H':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.06: d1jr0h_
• Heterogens: A24, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jr0D (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jr0E (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jr0F (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jr0G (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jr0H (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman