PDB entry 1jqw

View 1jqw on RCSB PDB site
Description: the 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex
Class: signaling protein
Keywords: autoinducer synthesis, signaling protein
Deposited on 2001-08-09, released 2001-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Bacillus subtilis [TaxId:1423]
    Gene: luxS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34667 (Start-156)
      • modified residue (83)
      • engineered (95)
    Domains in SCOPe 2.06: d1jqwa_
  • Heterogens: ZN, HCS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jqwA (A:)
mpsvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehll
aftirshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipa
anekqcgqaklhdlegakrlmrfwlsqdkeellkvfg

    Sequence, based on observed residues (ATOM records): (download) 
    >1jqwA (A:)
eldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaftirsh
aekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaanekqcg
qaklhdlegakrlmrfwlsqdkeellkvfg