PDB entry 1jqv

View 1jqv on RCSB PDB site
Description: The K213E mutant of Lactococcus lactis Dihydroorotate dehydrogenase A
Class: oxidoreductase
Keywords: Homodimer, alpha-beta barrel, flavoprotein, orotate complex, mutant enzyme, OXIDOREDUCTASE
Deposited on 2001-08-09, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54321 (0-310)
      • engineered (212)
    Domains in SCOPe 2.07: d1jqva_
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase a
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54321 (0-310)
      • engineered (212)
    Domains in SCOPe 2.07: d1jqvb_
  • Heterogens: MG, FMN, ORO, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqvA (A:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpedgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqvB (B:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpedgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl