PDB entry 1jqt

View 1jqt on RCSB PDB site
Description: Fitting of L11 protein in the low resolution cryo-EM map of E.coli 70S ribosome
Deposited on 2001-08-07, released 2001-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-14, with a file datestamp of 2002-06-14.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jqta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqtA (A:)
    akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
    edksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansl
    eaamkiiegtaksmgievv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqtA (A:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv