PDB entry 1jqs

View 1jqs on RCSB PDB site
Description: Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of E. coli 70S ribosome bound with EF-G and GMPPCP, a nonhydrolysable GTP analog
Class: ribosome
Keywords: L11, EF-G, cryo-EM, 70S E.coli ribosome, GTP state
Deposited on 2001-08-07, released 2001-09-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jqsa_
  • Chain 'B':
    Compound: Elongation factor G
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jqsb_
  • Chain 'C':
    Compound: Elongation factor G
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1jqsc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqsA (A:)
    akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
    edksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansl
    eaamkiiegtaksmgievv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqsA (A:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqsB (B:)
    aadfdenimlkylegeepteeelvaairkgti
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqsC (C:)
    mrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqg
    rgsfvmff