PDB entry 1jqr

View 1jqr on RCSB PDB site
Description: nmr structure of the african swine fever virus dna polymerase x
Deposited on 2001-08-08, released 2001-10-26
The last revision prior to the SCOP 1.67 freeze date was dated 2001-10-26, with a file datestamp of 2001-10-26.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1jqra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jqrA (A:)
mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl