PDB entry 1jqo

View 1jqo on RCSB PDB site
Description: Crystal structure of C4-form phosphoenolpyruvate carboxylase from maize
Class: lyase
Keywords: BETA BARREL, Carbon dioxide fixation
Deposited on 2001-08-07, released 2003-01-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxylase
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jqoa_
  • Chain 'B':
    Compound: phosphoenolpyruvate carboxylase
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jqob_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqoA (A:)
    mastkapgpgekhhsidaqlrqlvpgkvseddklieydallvdrflnilqdlhgpslref
    vqecyevsadyegkgdttklgelgakltglapadailvassilhmlnlanlaeevqiahr
    rrnsklkkggfadegsattesdieetlkrlvsevgkspeevfealknqtvdlvftahptq
    sarrsllqknarirncltqlnakditdddkqeldealqreiqaafrtdeirraqptpqae
    mrygmsyihetvwkgvpkflrrvdtalkniginerlpynvslirfsswmggdrdgnprvt
    pevtrdvcllarmmaanlyidqieelmfelsmwrcndelrvraeelhsssgskvtkyyie
    fwkqippnepyrvilghvrdklyntrerarhllasgvseisaessftsieefleplelcy
    kslcdcgdkaiadgslldllrqvftfglslvkldirqeserhtdvidaitthlgigsyre
    wpedkrqewllselrgkrpllppdlpqtdeiadvigafhvlaelppdsfgpyiismatap
    sdvlavellqrecgvrqplpvvplferladlqsapasverlfsvdwymdrikgkqqvmvg
    ysdsgkdagrlsaawqlyraqeemaqvakrygvkltlfhgrggtvgrgggpthlailsqp
    pdtingsirvtvqgeviefcfgeehlcfqtlqrftaatlehgmhppvspkpewrklmdem
    avvateeyrsvvvkearfveyfrsatpeteygrmnigsrpakrrpgggittlraipwifs
    wtqtrfhlpvwlgvgaafkfaidkdvrnfqvlkemynewpffrvtldllemvfakgdpgi
    aglydellvaeelkpfgkqlrdkyvetqqlllqiaghkdilegdpflkqglvlrnpyitt
    lnvfqaytlkrirdpnfkvtpqpplskefadenkpaglvklnpaseyppgledtliltmk
    giaagmqntg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqoA (A:)
    ieydallvdrflnilqdlhgpslrefvqecyevsadyegkgdttklgelgakltglapad
    ailvassilhmlnlanlaeevqiahrrrnsdieetlkrlvsevgkspeevfealknqtvd
    lvftahptqsarrsllqknarirncltqlnakditdddkqeldealqreiqaafrtdeir
    raqptpqaemrygmsyihetvwkgvpkflrrvdtalkniginerlpynvslirfsswmgg
    drdgnprvtpevtrdvcllarmmaanlyidqieelmfelsmwrcndelrvraeelhsssg
    skvtkyyiefwkqippnepyrvilghvrdklyntrerarhllasgvseisaessftsiee
    fleplelcykslcdcgdkaiadgslldllrqvftfglslvkldirqeserhtdvidaitt
    hlgigsyrewpedkrqewllselrgkrpllppdlpqtdeiadvigafhvlaelppdsfgp
    yiismatapsdvlavellqrecgvrqplpvvplferladlqsapasverlfsvdwymdri
    kgkqqvmvgysdsgkdagrlsaawqlyraqeemaqvakrygvkltlfhgrggtvgrgggp
    thlailsqppdtingsirvtvqgeviefcfgeehlcfqtlqrftaatlehgmhppvspkp
    ewrklmdemavvateeyrsvvvkearfveyfrsatpeteygrmnigsrpittlraipwif
    swtqtrfhlpvwlgvgaafkfaidkdvrnfqvlkemynewpffrvtldllemvfakgdpg
    iaglydellvaeelkpfgkqlrdkyvetqqlllqiaghkdilegdpflkqglvlrnpyit
    tlnvfqaytlkrirdpnfkvtpqpplskeaglvklnpaseyppgledtliltmkgiaagm
    qntg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jqoB (B:)
    mastkapgpgekhhsidaqlrqlvpgkvseddklieydallvdrflnilqdlhgpslref
    vqecyevsadyegkgdttklgelgakltglapadailvassilhmlnlanlaeevqiahr
    rrnsklkkggfadegsattesdieetlkrlvsevgkspeevfealknqtvdlvftahptq
    sarrsllqknarirncltqlnakditdddkqeldealqreiqaafrtdeirraqptpqae
    mrygmsyihetvwkgvpkflrrvdtalkniginerlpynvslirfsswmggdrdgnprvt
    pevtrdvcllarmmaanlyidqieelmfelsmwrcndelrvraeelhsssgskvtkyyie
    fwkqippnepyrvilghvrdklyntrerarhllasgvseisaessftsieefleplelcy
    kslcdcgdkaiadgslldllrqvftfglslvkldirqeserhtdvidaitthlgigsyre
    wpedkrqewllselrgkrpllppdlpqtdeiadvigafhvlaelppdsfgpyiismatap
    sdvlavellqrecgvrqplpvvplferladlqsapasverlfsvdwymdrikgkqqvmvg
    ysdsgkdagrlsaawqlyraqeemaqvakrygvkltlfhgrggtvgrgggpthlailsqp
    pdtingsirvtvqgeviefcfgeehlcfqtlqrftaatlehgmhppvspkpewrklmdem
    avvateeyrsvvvkearfveyfrsatpeteygrmnigsrpakrrpgggittlraipwifs
    wtqtrfhlpvwlgvgaafkfaidkdvrnfqvlkemynewpffrvtldllemvfakgdpgi
    aglydellvaeelkpfgkqlrdkyvetqqlllqiaghkdilegdpflkqglvlrnpyitt
    lnvfqaytlkrirdpnfkvtpqpplskefadenkpaglvklnpaseyppgledtliltmk
    giaagmqntg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqoB (B:)
    ieydallvdrflnilqdlhgpslrefvqecyevsadyegkgdttklgelgakltglapad
    ailvassilhmlnlanlaeevqiahrrrnsdieetlkrlvsevgkspeevfealknqtvd
    lvftahptqsarrsllqknarirncltqlnakditdddkqeldealqreiqaafrtdeir
    raqptpqaemrygmsyihetvwkgvpkflrrvdtalkniginerlpynvslirfsswmgg
    drdgnprvtpevtrdvcllarmmaanlyidqieelmfelsmwrcndelrvraeelhsssg
    skvtkyyiefwkqippnepyrvilghvrdklyntrerarhllasgvseisaessftsiee
    fleplelcykslcdcgdkaiadgslldllrqvftfglslvkldirqeserhtdvidaitt
    hlgigsyrewpedkrqewllselrgkrpllppdlpqtdeiadvigafhvlaelppdsfgp
    yiismatapsdvlavellqrecgvrqplpvvplferladlqsapasverlfsvdwymdri
    kgkqqvmvgysdsgkdagrlsaawqlyraqeemaqvakrygvkltlfhgrggtvgrgggp
    thlailsqppdtingsirvtvqgeviefcfgeehlcfqtlqrftaatlehgmhppvspkp
    ewrklmdemavvateeyrsvvvkearfveyfrsatpeteygrmnigsrpittlraipwif
    swtqtrfhlpvwlgvgaafkfaidkdvrnfqvlkemynewpffrvtldllemvfakgdpg
    iaglydellvaeelkpfgkqlrdkyvetqqlllqiaghkdilegdpflkqglvlrnpyit
    tlnvfqaytlkrirdpnfkvtpqpplskeaglvklnpaseyppgledtliltmkgiaagm
    qntg