PDB entry 1jqn

View 1jqn on RCSB PDB site
Description: Crystal structure of E.coli phosphoenolpyruvate carboxylase in complex with Mn2+ and DCDP
Class: lyase
Keywords: BETA BARREL, Mn2+ and DCDP COMPLEX
Deposited on 2001-08-07, released 2003-01-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxylase
    Species: Escherichia coli
    Gene: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jqna_
  • Heterogens: MN, ASP, DCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqnA (A:)
    mneqysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttl
    qnlsndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsed
    tikkaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrq
    liaqswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvef
    vpvrftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpell
    alvgeegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacy
    qslqacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyes
    wseadkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktp
    sdvlavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmig
    ysdsakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqp
    pgslkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdel
    sviscdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakrrptggveslraipwifa
    wtqnrlmlpawlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlae
    yydqrlvdkalwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdpln
    vlqaellhrsrqaekegqepdprveqalmvtiagiaagmrntg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqnA (A:)
    qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
    sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
    kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
    qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
    rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
    geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
    qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
    adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
    lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
    sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
    lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
    scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpggveslraipwifawtqnrlmlp
    awlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyydqrlvdk
    alwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlqaellhr
    srqaekegqepdprveqalmvtiagiaagmrntg