PDB entry 1jql

View 1jql on RCSB PDB site
Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of beta-delta (1-140)
Deposited on 2001-08-07, released 2001-09-26
The last revision prior to the SCOP 1.67 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.249
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqlA (A:)
    mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
    qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
    dwqseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavc
    smpigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgr
    fpdyrrvlpknpdkhleagcdllkqafaraaaasnekfrgvrlyvsenqlkitannpeqe
    eaeeildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayv
    vmpmrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqlB (B:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcq