PDB entry 1jqj

View 1jqj on RCSB PDB site
Description: Mechanism of Processivity Clamp Opening by the Delta Subunit Wrench of the Clamp Loader Complex of E. coli DNA Polymerase III: Structure of the beta-delta complex
Class: transferase
Keywords: DNA Polymerase, Processivity Clamp, Clamp Loader, DNA Replication, AAA+ ATPase
Deposited on 2001-08-07, released 2001-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.266
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase III, BETA CHAIN
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A988 (0-365)
      • engineered (271-272)
    Domains in SCOP 1.73: d1jqja1, d1jqja2, d1jqja3
  • Chain 'B':
    Compound: DNA Polymerase III, BETA CHAIN
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A988 (0-365)
      • engineered (271-272)
    Domains in SCOP 1.73: d1jqjb1, d1jqjb2, d1jqjb3
  • Chain 'C':
    Compound: DNA Polymerase III, DELTA SUBUNIT
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jqjc1, d1jqjc2
  • Chain 'D':
    Compound: DNA Polymerase III, DELTA SUBUNIT
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jqjd1, d1jqjd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqjA (A:)
    mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
    qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
    dwqseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavc
    smpigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgr
    fpdyrrvlpknpdkhleagcdllkqafaraaaasnekfrgvrlyvsenqlkitannpeqe
    eaeeildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayv
    vmpmrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqjB (B:)
    mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
    qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
    dwqseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavc
    smpigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgr
    fpdyrrvlpknpdkhleagcdllkqafaraaaasnekfrgvrlyvsenqlkitannpeqe
    eaeeildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayv
    vmpmrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jqjC (C:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqjC (C:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwrrgmmgealnrlsqtqlrqav
    qlltrteltlkqdygqaeleglslllch
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jqjD (D:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqjD (D:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndatpfhwvdallmgkskralhilqqlrlegsep
    villrtlqrellllvnlkrqsahtplralfdkhrvwrrgmmgealnrlsqtqlrqavqll
    trteltlkqdygqaeleglslllch