PDB entry 1jqi

View 1jqi on RCSB PDB site
Description: Crystal Structure of Rat Short Chain Acyl-CoA Dehydrogenase Complexed With Acetoacetyl-CoA
Class: oxidoreductase
Keywords: flavoprotein, enzyme-inhibitor complex, oxidoreductase
Deposited on 2001-08-07, released 2002-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.168
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short chain acyl-CoA dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jqia1, d1jqia2
  • Chain 'B':
    Compound: short chain acyl-CoA dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jqib1, d1jqib2
  • Heterogens: CAA, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqiA (A:)
    lhsvyqsvelpethqmlrqtcrdfaekelvpiaaqldkehlfptsqvkkmgelgllamdv
    peelsgagldylaysialeeisrgcastgvimsvnnslylgpilkfgssqqkqqwitpft
    ngdkigcfalsepgngsdagaasttareegdswvlngtkawitnsweasatvvfastdrs
    rqnkgisaflvpmptpgltlgkkedklgirasstanlifedcripkenllgepgmgfkia
    mqtldmgrigiasqalgiaqasldcavkyaenrhafgapltklqniqfkladmalalesa
    rlltwraamlkdnkkpftkesamaklaaseaataishqaiqilggmgyvtempaeryyrd
    ariteiyegtseiqrlviaghllrsyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqiA (A:)
    vyqsvelpethqmlrqtcrdfaekelvpiaaqldkehlfptsqvkkmgelgllamdvpee
    lsgagldylaysialeeisrgcastgvimsvnnslylgpilkfgssqqkqqwitpftngd
    kigcfalsepgngsdagaasttareegdswvlngtkawitnsweasatvvfastdrsrqn
    kgisaflvpmptpgltlgkkedklgirasstanlifedcripkenllgepgmgfkiamqt
    ldmgrigiasqalgiaqasldcavkyaenrhafgapltklqniqfkladmalalesarll
    twraamlkdnkkpftkesamaklaaseaataishqaiqilggmgyvtempaeryyrdari
    teiyegtseiqrlviaghllrsyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jqiB (B:)
    lhsvyqsvelpethqmlrqtcrdfaekelvpiaaqldkehlfptsqvkkmgelgllamdv
    peelsgagldylaysialeeisrgcastgvimsvnnslylgpilkfgssqqkqqwitpft
    ngdkigcfalsepgngsdagaasttareegdswvlngtkawitnsweasatvvfastdrs
    rqnkgisaflvpmptpgltlgkkedklgirasstanlifedcripkenllgepgmgfkia
    mqtldmgrigiasqalgiaqasldcavkyaenrhafgapltklqniqfkladmalalesa
    rlltwraamlkdnkkpftkesamaklaaseaataishqaiqilggmgyvtempaeryyrd
    ariteiyegtseiqrlviaghllrsyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqiB (B:)
    vyqsvelpethqmlrqtcrdfaekelvpiaaqldkehlfptsqvkkmgelgllamdvpee
    lsgagldylaysialeeisrgcastgvimsvnnslylgpilkfgssqqkqqwitpftngd
    kigcfalsepgngsdagaasttareegdswvlngtkawitnsweasatvvfastdrsrqn
    kgisaflvpmptpgltlgkkedklgirasstanlifedcripkenllgepgmgfkiamqt
    ldmgrigiasqalgiaqasldcavkyaenrhafgapltklqniqfkladmalalesarll
    twraamlkdnkkpftkesamaklaaseaataishqaiqilggmgyvtempaeryyrdari
    teiyegtseiqrlviaghllrsyr