PDB entry 1jqf

View 1jqf on RCSB PDB site
Description: Human Transferrin N-Lobe Mutant H249Q
Class: transport protein
Keywords: iron binding protein, TRANSPORT PROTEIN
Deposited on 2001-08-06, released 2001-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.221
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02787
      • engineered (248)
    Domains in SCOPe 2.06: d1jqfa_
  • Heterogens: CO3, FE, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqfA (A:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpsqtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqfA (A:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
    laqvpsqtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc