PDB entry 1jqb

View 1jqb on RCSB PDB site
Description: alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability
Deposited on 2001-08-05, released 2002-11-13
The last revision prior to the SCOP 1.71 freeze date was dated 2002-11-13, with a file datestamp of 2002-11-13.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqbA (A:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiemgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghiedqvmkltngkgvdrvi
    magggsetlsqavkmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raerlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqbB (B:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiemgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghiedqvmkltngkgvdrvi
    magggsetlsqavkmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raerlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqbC (C:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiemgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghiedqvmkltngkgvdrvi
    magggsetlsqavkmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raerlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jqbD (D:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiemgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghiedqvmkltngkgvdrvi
    magggsetlsqavkmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raerlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil