PDB entry 1jqa

View 1jqa on RCSB PDB site
Description: bacillus stearothermophilus glycerol dehydrogenase complex with glycerol
Deposited on 2001-08-04, released 2001-10-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jqaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqaA (A:)
    aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
    evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
    daptsalsviysddgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvear
    sviksggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantll
    sglgfesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryiel
    ylcldlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyak
    aykek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqaA (A:)
    aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
    evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
    daptsalsviyvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvearsvik
    sggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantllsglg
    fesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryielylcl
    dlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyakayke
    k