PDB entry 1jq9
View 1jq9 on RCSB PDB site
Description: Crystal structure of a complex formed between phospholipase A2 from Daboia russelli pulchella and a designed pentapeptide Phe-Leu-Ser-Tyr-Lys at 1.8 resolution
Class: hydrolase/hydrolase inhibitor
Keywords: phospholipase A2, Daboia russelli pulchella, neurotoxic, designed peptide, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on
2001-08-04, released
2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Daboia russellii pulchella [TaxId:97228]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1jq9a_ - Chain 'B':
Compound: phospholipase a2
Species: Daboia russellii pulchella [TaxId:97228]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1jq9b_ - Chain 'P':
Compound: peptide inhibitor
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq9A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq9B (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
- Chain 'P':
No sequence available.