PDB entry 1jq9

View 1jq9 on RCSB PDB site
Description: Crystal structure of a complex formed between phospholipase A2 from Daboia russelli pulchella and a designed pentapeptide Phe-Leu-Ser-Tyr-Lys at 1.8 resolution
Class: hydrolase
Keywords: Structure, phospholipase A2, Daboia russelli pulchella, neurotoxic, designed peptide
Deposited on 2001-08-04, released 2002-11-06
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russelli pulchella
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-49)
  Domains in SCOP 1.73: d1jq9a_
• Chain 'B':
  Compound: phospholipase a2
  Species: Daboia russelli pulchella
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-49)
  Domains in SCOP 1.73: d1jq9b_
• Chain 'P':
  Compound: peptide inhibitor
  Species: synthetic, synthetic
  
• Heterogens: ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq9A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq9B (B:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'P':
  No sequence available.