PDB entry 1jq8

View 1jq8 on RCSB PDB site
Description: design of specific inhibitors of phospholipase a2: crystal structure of a complex formed between phospholipase a2 from daboia russelli pulchella and a designed pentapeptide leu-ala-ile-tyr-ser at 2.0 resolution
Deposited on 2001-08-04, released 2002-11-06
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jq8a_
  • Chain 'B':
    Domains in SCOP 1.69: d1jq8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq8A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq8B (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c