PDB entry 1jq8

View 1jq8 on RCSB PDB site
Description: Design of specific inhibitors of phospholipase A2: Crystal structure of a complex formed between phospholipase A2 from Daboia russelli pulchella and a designed pentapeptide Leu-Ala-Ile-Tyr-Ser at 2.0 resolution
Class: hydrolase/hydrolase inhibitor
Keywords: neurotoxic, designed peptide, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2001-08-04, released 2002-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • PDB 1JQ8 (0-120)
  Domains in SCOPe 2.08: d1jq8a_
• Chain 'B':
  Compound: phospholipase a2
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • PDB 1JQ8 (0-120)
  Domains in SCOPe 2.08: d1jq8b_
• Chain 'P':
  Compound: peptide inhibitor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1JQ8 (0-4)
• Heterogens: SO4, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq8A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq8B (B:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'P':
  No sequence available.