PDB entry 1jq4

View 1jq4 on RCSB PDB site
Description: [2Fe-2S] Domain of Methane Monooxygenase Reductase from Methylococcus capsulatus (Bath)
Deposited on 2001-08-03, released 2002-01-09
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-09, with a file datestamp of 2002-01-09.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jq4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jq4A (A:)
    mqrvhtitavtedgeslrfecrsdedvitaalrqniflmsscreggcatckalcsegdyd
    lkgcsvqalppeeeeeglvllcrtypktdleielpyth