PDB entry 1jq2

View 1jq2 on RCSB PDB site
Description: potassium channel (kcsa) open gate model
Class: membrane protein
Keywords: potassium channel, integral membrane protein, open state
Deposited on 2001-08-03, released 2001-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Voltage-gated potassium channel
  Species: Streptomyces lividans [TaxId:1916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A334 (0-33)
    • engineered (4)
  Domains in SCOPe 2.05: d1jq2a_
• Chain 'B':
  Compound: Voltage-gated potassium channel
  Species: Streptomyces lividans [TaxId:1916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A334 (0-33)
    • engineered (4)
  Domains in SCOPe 2.05: d1jq2b_
• Chain 'C':
  Compound: Voltage-gated potassium channel
  Species: Streptomyces lividans [TaxId:1916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A334 (0-33)
    • engineered (4)
  Domains in SCOPe 2.05: d1jq2c_
• Chain 'D':
  Compound: Voltage-gated potassium channel
  Species: Streptomyces lividans [TaxId:1916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A334 (0-33)
    • engineered (4)
  Domains in SCOPe 2.05: d1jq2d_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq2A (A:)
  lwgrcvavvvmvagitsfglvtaalatwfvgreq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq2B (B:)
  lwgrcvavvvmvagitsfglvtaalatwfvgreq
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq2C (C:)
  lwgrcvavvvmvagitsfglvtaalatwfvgreq
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq2D (D:)
  lwgrcvavvvmvagitsfglvtaalatwfvgreq