PDB entry 1jq2
View 1jq2 on RCSB PDB site
Description: potassium channel (kcsa) open gate model
Class: membrane protein
Keywords: potassium channel, integral membrane protein, open state
Deposited on
2001-08-03, released
2001-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1jq2a_ - Chain 'B':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1jq2b_ - Chain 'C':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1jq2c_ - Chain 'D':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1jq2d_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq2A (A:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq2B (B:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq2C (C:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq2D (D:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq