PDB entry 1jq2

View 1jq2 on RCSB PDB site
Description: potassium channel (kcsa) open gate model
Deposited on 2001-08-03, released 2001-10-03
The last revision prior to the SCOP 1.61 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: NMR50
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jq2a_
  • Chain 'B':
    Domains in SCOP 1.61: d1jq2b_
  • Chain 'C':
    Domains in SCOP 1.61: d1jq2c_
  • Chain 'D':
    Domains in SCOP 1.61: d1jq2d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq2A (A:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq2B (B:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq2C (C:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq2D (D:)
lwgrcvavvvmvagitsfglvtaalatwfvgreq