PDB entry 1jq0

View 1jq0 on RCSB PDB site
Description: mutation that destabilize the gp41 core: determinants for stabilizing the siv/cpmac envelope glycoprotein complex. mutant structure.
Deposited on 2001-08-03, released 2002-04-24
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jq0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jq0A (A:)
lagivqqqqqlldlvtrqqellrltvwgiknlqtrvtsggrggwqewkrkvdfleenita
lleeaqiqqeknmyelqk

    Sequence, based on observed residues (ATOM records): (download) 
    >1jq0A (A:)
lagivqqqqqlldlvtrqqellrltvwgiknlqtggwqewkrkvdfleenitalleeaqi
qqeknmyelqk