PDB entry 1jpz

View 1jpz on RCSB PDB site
Description: Crystal structure of a complex of the heme domain of P450BM-3 with N-Palmitoylglycine
Class: oxidoreductase
Keywords: Protein-substrate complex, hemeprotein
Deposited on 2001-08-03, released 2001-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.177
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpza_
  • Chain 'B':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpzb_
  • Heterogens: HEM, 140, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jpzA (A:)
    gamtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrl
    ikeacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyha
    mmvdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsm
    vraldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthm
    lngkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarv
    lvdpvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvli
    pqlhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmm
    lkhfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpzA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasqsddllthmlngkd
    petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
    psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
    dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
    fedhtnyeldiketltlkpegfvvkakskkiplggi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jpzB (B:)
    gamtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrl
    ikeacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyha
    mmvdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsm
    vraldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthm
    lngkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarv
    lvdpvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvli
    pqlhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmm
    lkhfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpzB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggi