PDB entry 1jpw

View 1jpw on RCSB PDB site
Description: Crystal Structure of a Human Tcf-4 / beta-Catenin Complex
Class: cell adhesion
Keywords: beta-catenin, tcf, tcf4, colon cancer, armadillo repeat, transcription factor
Deposited on 2001-08-03, released 2001-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2001-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.304
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpwa_
  • Chain 'B':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpwb_
  • Chain 'C':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpwc_
  • Chain 'D':
    Compound: transcription factor 7-like 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpwd_
  • Chain 'E':
    Compound: transcription factor 7-like 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpwe_
  • Chain 'F':
    Compound: transcription factor 7-like 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpwf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jpwA (A:)
    mgshavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimr
    spqmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvds
    vlfyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqe
    skliilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhl
    tdpsqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcn
    nyknkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyg
    lpvvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrr
    tsmggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieni
    qrvaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsedkpqdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpwA (A:)
    raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
    arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
    mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
    ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
    aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
    vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
    vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeivegctgalhil
    ardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapl
    tellhsrnegvatyaaavlfrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jpwB (B:)
    mgshavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimr
    spqmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvds
    vlfyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqe
    skliilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhl
    tdpsqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcn
    nyknkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyg
    lpvvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrr
    tsmggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieni
    qrvaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsedkpqdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpwB (B:)
    raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
    arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
    mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
    ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
    aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
    vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
    vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeivegctgalhil
    ardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapl
    tellhsrnegvatyaaavlfrm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jpwC (C:)
    mgshavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimr
    spqmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvds
    vlfyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqe
    skliilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhl
    tdpsqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcn
    nyknkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyg
    lpvvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrr
    tsmggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieni
    qrvaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsedkpqdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpwC (C:)
    raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
    arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
    mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
    ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
    aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
    vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
    vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeivegctgalhil
    ardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapl
    tellhsrnegvatyaaavlfrm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jpwD (D:)
    gsggddlgandelisfkdegeqeekssenssaerdladvksslvneset
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpwD (D:)
    gandelisfkdegdladvksslvn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jpwE (E:)
    gsggddlgandelisfkdegeqeekssenssaerdladvksslvneset
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpwE (E:)
    gandelisfkdegdladvksslvn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jpwF (F:)
    gsggddlgandelisfkdegeqeekssenssaerdladvksslvneset
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpwF (F:)
    gandelisfkdegdladvksslvn