PDB entry 1jpt

View 1jpt on RCSB PDB site
Description: Crystal Structure of Fab D3H44
Class: immune system
Keywords: antigen-antibody recognition, humanized antibody, blood coagulation, crystal structure, IMMUNE SYSTEM
Deposited on 2001-08-03, released 2002-02-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin Fab D3H44, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JPT (0-End)
    Domains in SCOPe 2.05: d1jpth1, d1jpth2
  • Chain 'L':
    Compound: immunoglobulin Fab D3h44, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JPT (0-End)
    Domains in SCOPe 2.05: d1jptl1, d1jptl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jptH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jptH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jptL (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jptL (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge