PDB entry 1jps

View 1jps on RCSB PDB site
Description: Crystal structure of tissue factor in complex with humanized Fab D3h44
Class: immune system
Keywords: antigen-antibody recognition, humanized antibody, blood coagulation, interface water molecules, crystal structure
Deposited on 2001-08-03, released 2002-02-03
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin Fab D3H44, heavy chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1jpsh1, d1jpsh2
  • Chain 'L':
    Compound: immunoglobulin Fab D3h44, light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1jpsl1, d1jpsl2
  • Chain 'T':
    Compound: tissue factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jpst1, d1jpst2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jpsH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpsH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jpsL (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpsL (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1jpsT (T:)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpsT (T:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnveplyenspeftpyletnlgqptiqsfeqvgtkvnvtveder
    tlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsvqa
    vipsrtvnrkstdspvecmg