PDB entry 1jpn

View 1jpn on RCSB PDB site
Description: GMPPNP Complex of SRP GTPase NG Domain
Deposited on 2001-08-02, released 2002-02-02
The last revision prior to the SCOP 1.67 freeze date was dated 2002-02-02, with a file datestamp of 2002-02-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jpnA (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jpnB (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpnB (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmg