PDB entry 1jpm

View 1jpm on RCSB PDB site
Description:
Deposited on 2001-08-02, released 2001-12-21
The last revision prior to the SCOP 1.67 freeze date was dated 2001-12-21, with a file datestamp of 2001-12-21.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jpma1, d1jpma2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jpmb1, d1jpmb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jpmc1, d1jpmc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jpmd1, d1jpmd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jpmA (A:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmA (A:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jpmB (B:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmB (B:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jpmC (C:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmC (C:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jpmD (D:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmD (D:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa