PDB entry 1jpm

View 1jpm on RCSB PDB site
Description: L-Ala-D/L-Glu Epimerase
Class: isomerase
Keywords: Enolase superfamily, muconate lactonizing subgroup, alpha-beta barrel, ISOMERASE
Deposited on 2001-08-02, released 2001-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-Ala-D/L-Glu Epimerase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykfB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jpma1, d1jpma2
  • Chain 'B':
    Compound: L-Ala-D/L-Glu Epimerase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykfB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jpmb1, d1jpmb2
  • Chain 'C':
    Compound: L-Ala-D/L-Glu Epimerase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykfB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jpmc1, d1jpmc2
  • Chain 'D':
    Compound: L-Ala-D/L-Glu Epimerase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykfB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jpmd1, d1jpmd2
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jpmA (A:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmA (A:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jpmB (B:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmB (B:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jpmC (C:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmC (C:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jpmD (D:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpmD (D:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa