PDB entry 1jpl

View 1jpl on RCSB PDB site
Description: GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose 6-phosphate receptor
Class: signaling protein
Keywords: Protein-peptide complex; VHS domain; DXXLL sorting signal, SIGNALING PROTEIN
Deposited on 2001-08-02, released 2002-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • cloning artifact (1-4)
      • modified residue (5)
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.06: d1jpla1, d1jpla2
  • Chain 'B':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • cloning artifact (2-4)
      • modified residue (5)
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.06: d1jplb1, d1jplb2
  • Chain 'C':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • cloning artifact (2-4)
      • modified residue (5)
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.06: d1jplc1, d1jplc2
  • Chain 'D':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • cloning artifact (1-4)
      • modified residue (5)
      • modified residue (77)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.06: d1jpld1, d1jpld2
  • Chain 'E':
    Compound: Cation-Independent Mannose 6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cation-Independent Mannose 6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Cation-Independent Mannose 6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Cation-Independent Mannose 6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jplA (A:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jplA (A:)
    amgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqs
    pqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvie
    llyswtmalpeeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jplB (B:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jplB (B:)
    mgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqsp
    qewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviel
    lyswtmalpeeakikdayhmlkrqgivqsdppipvdrtl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jplC (C:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jplC (C:)
    mgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqsp
    qewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviel
    lyswtmalpeeakikdayhmlkrqgivqsdppipvdrtl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jplD (D:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jplD (D:)
    amgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqs
    pqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvie
    llyswtmalpeeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.