PDB entry 1jpf

View 1jpf on RCSB PDB site
Description: Crystal Structure Of The LCMV Peptidic Epitope Gp276 In Complex With The Murine Class I Mhc Molecule H-2Db
Class: immune system
Keywords: Ig fold
Deposited on 2001-08-02, released 2001-10-24
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpfa1, d1jpfa2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jpfb_
  • Chain 'C':
    Compound: LCMV peptidic epitope gp276
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jpfA (A:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpfA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrwep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jpfB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpfB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.