PDB entry 1jpd

View 1jpd on RCSB PDB site
Description:
Deposited on 2001-08-01, released 2001-12-21
The last revision prior to the SCOP 1.67 freeze date was dated 2001-12-21, with a file datestamp of 2001-12-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1jpdx1, d1jpdx2

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1jpdX (X:)
    gshmrtvkvfeeawplhtpfviargsrsearvvvveleeegikgtgectpyprygesdas
    vmaqimsvvpqlekgltreelqkilpagaarnaldcalwdlaarrqqqsladligitlpe
    tvitaqtvvigtpdqmansastlwqagakllkvkldnhlisermvairtavpdatlivda
    neswraeglaarcqlladlgvamleqplpaqddaalenfihplpicadeschtrsnlkal
    kgryemvnikldktggltealalatearaqgfslmlgcmlctsraisaalplvpqvsfad
    ldgptwlavdvepalqfttgelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpdX (X:)
    gshmrtvkvfeeawplhtpsrsearvvvveleeegikgtgectpyprygesdasvmaqim
    svvpqlekgltreelqkilpagaarnaldcalwdlaarrqqqsladligitlpetvitaq
    tvvigtpdqmansastlwqagakllkvkldnhlisermvairtavpdatlivdaneswra
    eglaarcqlladlgvamleqplpaqddaalenfihplpicadeschtrsnlkalkgryem
    vnikldktggltealalatearaqgfslmlgcmlctsraisaalplvpqvsfadldgptw
    lavdvepalqfttgelhl