PDB entry 1jp3

View 1jp3 on RCSB PDB site
Description: Structure of E.coli undecaprenyl pyrophosphate synthase
Deposited on 2001-07-31, released 2001-08-15
The last revision prior to the SCOP 1.65 freeze date was dated 2002-04-10, with a file datestamp of 2002-04-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1jp3a_
  • Chain 'B':
    Domains in SCOP 1.65: d1jp3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jp3A (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp3A (A:)
    lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsm
    elfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyg
    grwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfll
    wqiayaelyftdvlwpdfdeqdfegalnafanre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jp3B (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp3B (B:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssalme
    lfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanygg
    rwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllw
    qiayaelyftdvlwpdfdeqdfegalnafan